PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g063430.1.1
Common NameLOC101261423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 319aa    MW: 36858.8 Da    PI: 7.6646
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g063430.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-5291381129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yLkkk++ +k+++ evi+e+d++k+ePw+L+ +++     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+
  Solyc06g063430.1.1   9 VPPGFRFHPTEEELLHYYLKKKLSFHKFDM-EVIREIDLNKIEPWELQDRCNIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGR 98 
                         69****************************.99**************953333122556******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Solyc06g063430.1.1  99 DKCIRN-SFKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 138
                         *****9.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-587157IPR003441NAC domain
PROSITE profilePS5100557.199157IPR003441NAC domain
PfamPF023654.8E-2710137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASSSNGGVP PGFRFHPTEE ELLHYYLKKK LSFHKFDMEV IREIDLNKIE PWELQDRCNI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATNA GFWKATGRDK CIRNSFKKIG MRKTLVFYRG  120
RAPHGQKTDW IMHEYRLEDA DQNQNEDGWV ICRVFKKKNL FKITGNEAAS SSHHHQQPTN  180
NFTHKDNNHD HSPYLLHQLP QHHDQHHDLN YSQIPVATTL APHEYYSHNN NNIEVAQNLI  240
KSSSLGYHQH HHPHEFSSSG ADQSAPCESG LEVASSNDHQ WGINIDSSKV ALGMGFESNQ  300
INHQLPMRGE MDFWSYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-52915917167NAC domain-containing protein 19
4dul_A2e-52915917167NAC domain-containing protein 19
1ut7_B2e-52915917167NO APICAL MERISTEM PROTEIN
1ut7_A2e-52915917167NO APICAL MERISTEM PROTEIN
1ut4_B2e-52915917167NO APICAL MERISTEM PROTEIN
1ut4_A2e-52915917167NO APICAL MERISTEM PROTEIN
3swp_D2e-52915920170NAC domain-containing protein 19
3swp_C2e-52915920170NAC domain-containing protein 19
3swp_B2e-52915920170NAC domain-containing protein 19
3swp_A2e-52915920170NAC domain-containing protein 19
3swm_D2e-52915920170NAC domain-containing protein 19
3swm_C2e-52915920170NAC domain-containing protein 19
3swm_B2e-52915920170NAC domain-containing protein 19
3swm_A2e-52915920170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242260.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-116BRN2_ARATH; Protein BEARSKIN2
TrEMBLK4C7740.0K4C774_SOLLC; Uncharacterized protein
STRINGSolyc06g063430.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-103NAC domain containing protein 70
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]